OTP monoclonal antibody (M03), clone 8E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
OTP monoclonal antibody (M03), clone 8E12. Western Blot analysis of OTP expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of OTP expression in transfected 293T cell line by OTP monoclonal antibody (M03), clone 8E12.
Lane 1: OTP transfected lysate (Predicted MW: 34.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OTP is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OTP.
Immunogen
OTP (NP_115485.1, 11 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OTP monoclonal antibody (M03), clone 8E12. Western Blot analysis of OTP expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of OTP expression in transfected 293T cell line by OTP monoclonal antibody (M03), clone 8E12.
Lane 1: OTP transfected lysate (Predicted MW: 34.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OTP is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — OTP
Entrez GeneID
23440GeneBank Accession#
NM_032109Protein Accession#
NP_115485.1Gene Name
OTP
Gene Alias
MGC3161
Gene Description
orthopedia homeobox
Omim ID
604529Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the homeodomain (HD) family. HD family proteins are helix-turn-helix transcription factors that play key roles in the specification of cell fates. This protein may function during brain development. [provided by RefSeq
Other Designations
orthopedia homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com