PSIP1 monoclonal antibody (M01), clone 3H1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PSIP1 monoclonal antibody (M01), clone 3H1. Western Blot analysis of PSIP1 expression in human liver.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSIP1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (31.13 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PSIP1.
Immunogen
PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.13 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PSIP1 monoclonal antibody (M01), clone 3H1. Western Blot analysis of PSIP1 expression in human liver.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSIP1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — PSIP1
Entrez GeneID
11168GeneBank Accession#
BC033817Protein Accession#
AAH33817Gene Name
PSIP1
Gene Alias
DFS70, LEDGF, MGC74712, PAIP, PSIP2, p52, p75
Gene Description
PC4 and SFRS1 interacting protein 1
Omim ID
603620Gene Ontology
HyperlinkOther Designations
OTTHUMP00000022753|OTTHUMP00000022754|OTTHUMP00000022756|PC4 and SFRS1 interacting protein 2|transcriptional coactivator p52/p75
-
Interactome
-
Publication Reference
-
LEDGF/p75 functions downstream from preintegration complex formation to effect gene-specific HIV-1 integration.
Shun MC, Raghavendra NK, Vandegraaff N, Daigle JE, Hughes S, Kellam P, Cherepanov P, Engelman A.
Genes & Development 2007 Jul; 21(14):1767.
Application：WB-Ce, Mouse, MEF cells.
-
LEDGF/p75 functions downstream from preintegration complex formation to effect gene-specific HIV-1 integration.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com