CAMKK2 monoclonal antibody (M01), clone 1A11
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CAMKK2.
Immunogen
CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.93 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CAMKK2 monoclonal antibody (M01), clone 1A11 Western Blot analysis of CAMKK2 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
CAMKK2 monoclonal antibody (M01), clone 1A11. Western Blot analysis of CAMKK2 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CAMKK2 expression in transfected 293T cell line by CAMKK2 monoclonal antibody (M01), clone 1A11.
Lane 1: CAMKK2 transfected lysate(59.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of CAMKK2 transfected lysate using anti-CAMKK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CAMKK2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAMKK2 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — CAMKK2
Entrez GeneID
10645GeneBank Accession#
BC026060Protein Accession#
AAH26060Gene Name
CAMKK2
Gene Alias
CAMKK, CAMKKB, KIAA0787, MGC15254
Gene Description
calcium/calmodulin-dependent protein kinase kinase 2, beta
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. [provided by RefSeq
Other Designations
CAMKK beta protein|calcium/calmodulin-dependent protein kinase beta|calcium/calmodulin-dependent protein kinase kinase 2 beta
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Targeting CaMKK2 inhibits actin cytoskeletal assembly to suppress cancer metastasis.
Debarati Mukherjee, Rebecca A Previs, Corinne Haines, Muthana Al Abo, Patrick K Juras, Kyle C Strickland, Binita Chakraborty, Sandeep Artham, Regina S Whitaker, Katherine Hebert, Jake Fontenot, Steven R Patierno, Jennifer A Freedman, Frank H Lau, Matthew E Burow, Ching-Yi Chang, Donald P McDonnell.
Cancer Research 2023 Jun; [Epub]:0.
Application:WB-Tr, Human, BT20, MDA-MB-231-4175 cells.
-
Distinguishing parallel from series circuits with a double knockdown procedure in human cell lines.
Angela M Gocher-Demske, Shuhang Dai, Arthur M Edelman.
STAR Protocols 2022 Dec; 3(4):101890.
Application:WB, Human, NIH:OVCAR-3 cells.
-
The potent AMPK inhibitor BAY-3827 shows strong efficacy in androgen-dependent prostate cancer models.
Clara Lemos, Volker K Schulze, Simon J Baumgart, Ekaterina Nevedomskaya, Tobias Heinrich, Julien Lefranc, Benjamin Bader, Clara D Christ, Hans Briem, Lara P Kuhnke, Simon J Holton, Ulf Bömer, Philip Lienau, Franz von Nussbaum, Carl F Nising, Marcus Bauser, Andrea Hägebarth, Dominik Mumberg, Bernard Haendler
Cellular Oncology (Dordrecht) 2021 Jan; 44(3):581.
Application:WB, Human, LNCaP cells.
-
Utilizing the Dog Genome in the Search for Novel Candidate Genes Involved in Glioma Development-Genome Wide Association Mapping followed by Targeted Massive Parallel Sequencing Identifies a Strongly Associated Locus.
Truve K, Dickinson P, Xiong A, York D, Jayashankar K, Pielberg G, Koltookian M, Muren E, Fuxelius HH, Weishaupt H, Swartling FJ, Andersson G, Hedhammar A, Bongcam-Rudloff E, Forsberg-Nilsson K, Bannasch D, Lindblad-Toh K.
PLoS Genetics 2016 May; 12(5):e1006000.
Application:WB-Ti, Human, Brain.
-
A regulatory feedback loop between Ca2+/calmodulin-dependent protein kinase kinase 2 (CaMKK2) and the androgen receptor in prostate cancer progression.
Karacosta LG, Foster BA, Azabdaftari G, Feliciano DM, Edelman AM.
The Journal of Biological Chemistry 2012 Jul; 287(29):24832.
Application:WB, Human, Human prostate cancer, LNCaP.
-
Targeting CaMKK2 inhibits actin cytoskeletal assembly to suppress cancer metastasis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com