TACC3 monoclonal antibody (M02), clone 6C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TACC3.
Immunogen
TACC3 (NP_006333, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (66); Rat (75)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TACC3 monoclonal antibody (M02), clone 6C4 Western Blot analysis of TACC3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
TACC3 monoclonal antibody (M02), clone 6C4. Western Blot analysis of TACC3 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TACC3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TACC3 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — TACC3
Entrez GeneID
10460GeneBank Accession#
NM_006342Protein Accession#
NP_006333Gene Name
TACC3
Gene Alias
ERIC1, MGC117382, MGC133242
Gene Description
transforming, acidic coiled-coil containing protein 3
Omim ID
605303Gene Ontology
HyperlinkGene Summary
The function of this gene has not yet been determined; however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Male meiotic spindle poles are stabilized by TACC3 and cKAP5/chTOG differently from female meiotic or somatic mitotic spindles in mice.
Calvin Simerly, Emily Robertson, Caleb Harrison, Sydney Ward, Charlize George, Jasmine Deleon, Carrie Hartnett, Gerald Schatten.
Scientific Reports 2024 Feb; 14(1):4808.
Application:IF, Mouse, Fibroblast, Spermatocyte.
-
Male meiotic spindle poles are stabilized by TACC3 and cKAP5/chTOG differently from female meiotic or somatic mitotic spindles in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com