TCIRG1 monoclonal antibody (M02), clone 7H20
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TCIRG1.
Immunogen
TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TCIRG1
Entrez GeneID
10312GeneBank Accession#
BC018133Protein Accession#
AAH18133Gene Name
TCIRG1
Gene Alias
ATP6N1C, ATP6V0A3, Atp6i, OC-116kDa, OC116, OPTB1, Stv1, TIRC7, Vph1, a3
Gene Description
T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
Gene Ontology
HyperlinkGene Summary
Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq
Other Designations
ATPase, H+ transporting, 116kD|T cell immune response cDNA7 protein|T-cell immune regulator 1|T-cell, immune regulator 1|T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3|T-cell, immune regulator 1, ATPase, H+ transporting, lyso
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A comparison of osteoclast-rich and osteoclast-poor osteopetrosis in adult mice sheds light on the role of the osteoclast in coupling bone resorption and bone formation.
Thudium CS, Moscatelli I, Flores C, Thomsen JS, Bruel A, Gudmann NS, Hauge EM, Karsdal MA, Richter J, Henriksen K.
Calcified Tissue International 2014 Jul; 95(1):83.
Application:WB-Ti, Mouse, Bone.
-
A comparison of osteoclast-rich and osteoclast-poor osteopetrosis in adult mice sheds light on the role of the osteoclast in coupling bone resorption and bone formation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com