BCAS2 monoclonal antibody (M01), clone 1D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BCAS2 monoclonal antibody (M01), clone 1D10 Western Blot analysis of BCAS2 expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of BCAS2 expression in transfected 293T cell line by BCAS2 monoclonal antibody (M01), clone 1D10.
Lane 1: BCAS2 transfected lysate(26.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCAS2 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of BCAS2 over-expressed 293 cell line, cotransfected with BCAS2 Validated Chimera RNAi ( Cat # H00010286-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BCAS2 monoclonal antibody (M01), clone 1D10 (Cat # H00010286-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant BCAS2.
Immunogen
BCAS2 (NP_005863, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BCAS2 monoclonal antibody (M01), clone 1D10 Western Blot analysis of BCAS2 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of BCAS2 expression in transfected 293T cell line by BCAS2 monoclonal antibody (M01), clone 1D10.
Lane 1: BCAS2 transfected lysate(26.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCAS2 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of BCAS2 over-expressed 293 cell line, cotransfected with BCAS2 Validated Chimera RNAi ( Cat # H00010286-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BCAS2 monoclonal antibody (M01), clone 1D10 (Cat # H00010286-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — BCAS2
Entrez GeneID
10286GeneBank Accession#
NM_005872Protein Accession#
NP_005863Gene Name
BCAS2
Gene Alias
DAM1
Gene Description
breast carcinoma amplified sequence 2
Omim ID
605783Gene Ontology
HyperlinkGene Summary
amplified in breast cancer
Other Designations
OTTHUMP00000013668|spliceosome associated protein, amplified in breast cancer
-
Interactomes
-
Publication Reference
-
A Quantitative Proteomic Analysis Uncovers the Relevance of CUL3 in Bladder Cancer Aggressiveness.
Grau L, Luque-Garcia JL, Gonzalez-Peramato P, Theodorescu D, Palou J, Fernandez-Gomez JM, Sanchez-Carbayo M.
PLoS One 2013 Jan; 8(1):e53328.
Application：WB, Human, Bladder cancer cells T24, T24T.
-
A Quantitative Proteomic Analysis Uncovers the Relevance of CUL3 in Bladder Cancer Aggressiveness.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com