VDAC2 monoclonal antibody (M01), clone 3D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
VDAC2 monoclonal antibody (M01), clone 3D2. Western Blot analysis of VDAC2 expression in rat brain.
Western Blot (Cell lysate)
VDAC2 monoclonal antibody (M01), clone 3D2. Western Blot analysis of VDAC2 expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of VDAC2 expression in transfected 293T cell line by VDAC2 monoclonal antibody (M01), clone 3D2.
Lane 1: VDAC2 transfected lysate(31.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VDAC2 is 10 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to VDAC2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (57.86 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant VDAC2.
Immunogen
VDAC2 (AAH00165, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
VDAC2 monoclonal antibody (M01), clone 3D2. Western Blot analysis of VDAC2 expression in rat brain.Western Blot (Cell lysate)
VDAC2 monoclonal antibody (M01), clone 3D2. Western Blot analysis of VDAC2 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of VDAC2 expression in transfected 293T cell line by VDAC2 monoclonal antibody (M01), clone 3D2.
Lane 1: VDAC2 transfected lysate(31.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VDAC2 is 10 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to VDAC2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — VDAC2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com