UGP2 monoclonal antibody (M01), clone 3H3

Catalog # H00007360-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in NIH/3T3 ( Cat # L018V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

UGP2 monoclonal antibody (M01), clone 3H3 Western Blot analysis of UGP2 expression in HeLa ( Cat # L013V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in Raw 264.7 ( Cat # L024V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of UGP2 expression in transfected 293T cell line by UGP2 monoclonal antibody (M01), clone 3H3.

Lane 1: UGP2 transfected lysate(56.9 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged UGP2 is approximately 0.1ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of UGP2 over-expressed 293 cell line, cotransfected with UGP2 Validated Chimera RNAi ( Cat # H00007360-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UGP2 monoclonal antibody (M01), clone 3H3 (Cat # H00007360-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (35.64 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant UGP2.

    Immunogen

    UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (98); Rat (98)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (35.64 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in NIH/3T3 ( Cat # L018V1 ).

    Western Blot (Cell lysate)

    UGP2 monoclonal antibody (M01), clone 3H3 Western Blot analysis of UGP2 expression in HeLa ( Cat # L013V1 ).

    Western Blot (Cell lysate)

    UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    UGP2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of UGP2 expression in Raw 264.7 ( Cat # L024V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of UGP2 expression in transfected 293T cell line by UGP2 monoclonal antibody (M01), clone 3H3.

    Lane 1: UGP2 transfected lysate(56.9 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged UGP2 is approximately 0.1ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of UGP2 over-expressed 293 cell line, cotransfected with UGP2 Validated Chimera RNAi ( Cat # H00007360-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UGP2 monoclonal antibody (M01), clone 3H3 (Cat # H00007360-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — UGP2

    Entrez GeneID

    7360

    GeneBank Accession#

    NM_001001521

    Protein Accession#

    NP_001001521

    Gene Name

    UGP2

    Gene Alias

    UDPG, UDPGP2, UGPP2, pHC379

    Gene Description

    UDP-glucose pyrophosphorylase 2

    Omim ID

    191760

    Gene Ontology

    Hyperlink

    Gene Summary

    The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    UDP-glucose diphosphorylase|UGPase 2|UTP--glucose-1-phosphate uridylyltransferase 2|UTP-glucose-1-phosphate uridyltransferase|uridyl diphosphate glucose pyrophosphorylase 2

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All