TNNC1 monoclonal antibody (M01), clone 1F8-A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TNNC1.
Immunogen
TNNC1 (AAH30244, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.45 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TNNC1 expression in transfected 293T cell line by TNNC1 monoclonal antibody (M01), clone 1F8-A9.
Lane 1: TNNC1 transfected lysate(18.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TNNC1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNNC1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TNNC1
Entrez GeneID
7134GeneBank Accession#
BC030244Protein Accession#
AAH30244Gene Name
TNNC1
Gene Alias
CMD1Z, TNC, TNNC
Gene Description
troponin C type 1 (slow)
Omim ID
191040Gene Ontology
HyperlinkGene Summary
Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. [provided by RefSeq
Other Designations
cardiac troponin C|slow twitch skeletal/cardiac muscle troponin C|troponin C, slow|troponin C1, slow
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Toward nano-sized imprinted norepinephrine-derived biopolymer as artificial receptors for detecting IgG1 by surface plasmon resonance.
Francesca Torrini, Giovanni Ferraro, Emiliano Fratini, Pasquale Palladino, Simona Scarano, Maria Minunni.
Biosensors & Bioelectronics 2024 May; 252:116133.
Application:N/A, N/A, N/A.
-
Toward nano-sized imprinted norepinephrine-derived biopolymer as artificial receptors for detecting IgG1 by surface plasmon resonance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com