TLR4 monoclonal antibody (M02), clone 3B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TLR4.
Immunogen
TLR4 (NP_612564, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.32 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TLR4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]ELISA
-
Gene Info — TLR4
Entrez GeneID
7099GeneBank Accession#
NM_138554Protein Accession#
NP_612564Gene Name
TLR4
Gene Alias
ARMD10, CD284, TOLL, hToll
Gene Description
toll-like receptor 4
Omim ID
603030Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain. [provided by RefSeq
Other Designations
OTTHUMP00000022807|homolog of Drosophila toll
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Pathophysiology of reflux oesophagitis: role of Toll-like receptors 2 and 4 and Farnesoid X receptor.
Minna Nortunen, Nina Väkiparta, Katja Porvari, Juha Saarnio, Tuomo J Karttunen, Heikki Huhta.
Virchows Archiv : an International Journal of Pathology 2021 Aug; 479(2):285.
Application:IHC-P, Human, Oesophageal biopsy samples from patients with gastroesophageal reflux disease.
-
Toll-like receptors 2, 4 and 9 and hypoxia markers HIF-1alpha and CAIX in pancreatic intraepithelial neoplasia.
Leppänen J, Helminen O, Huhta H, Kauppila JH, Isohookana J, Haapasaari KM, Karihtala P, Parkkila S, Saarnio J, Lehenkari PP, Karttunen TJ.
APMIS : Acta Pathologica, Microbiologica, et Immunologica Scandinavica 2018 Nov; 126(11):852.
Application:IHC-P, Human, Human pancreatic intraepithelial neoplasia.
-
Toll-like receptor 2 and Toll-like receptor 4 predict favorable prognosis in local pancreatic cancer.
Lanki MA, Seppänen HE, Mustonen HK, Böckelman C, Juuti AT, Hagström JK, Haglund CH.
Tumour Biology : the Journal of the International Society for Oncodevelopmental Biology and Medicine 2018 Sep; 40(9):1010428318.
Application:IHC-P, Human, Human pancreatic cancer.
-
Divergent expression of bacterial wall sensing Toll-like receptors 2 and 4 in colorectal cancer.
Paarnio K, Väyrynen S, Klintrup K, Ohtonen P, Mäkinen MJ, Mäkelä J, Karttunen TJ.
World Journal of Gastroenterology 2017 Jul; 23(26):4831.
Application:IHC-P, Human, Human colorectal cancer.
-
High toll-like receptor (TLR) 9 expression is associated with better prognosis in surgically treated pancreatic cancer patients.
Leppänen J, Helminen O, Huhta H, Kauppila JH, Isohookana J, Haapasaari KM, Lehenkari P, Saarnio J, Karttunen TJ.
Virchows Archiv : an International Journal of Pathology 2017 Feb; 470(4):401.
Application:IHC-P, Human, Human pancreatic cancer.
-
Cathepsin K expression is increased in oral lichen planus.
Siponen M, Bitu CC, Al-Samadi A, Nieminen P, Salo T.
Journal of Oral Pathology & Medicine 2016 Nov; 45(10):758.
Application:IHC-P, Human, Oral lichen planus.
-
Toll-Like Receptor 4 Wild Type Homozygozity of Polymorphisms +896 and +1196 Is Associated with High Gastrin Serum Levels and Peptic Ulcer Risk.
Pohjanen VM, Koivurova OP, Huhta H, Helminen O, Makinen JM, Karhukorpi JM, Joensuu T, Koistinen PO, Valtonen JM, Niemela SE, Karttunen RA, Karttunen TJ.
PloS One 2015 Jul; 10(7):e0131553.
Application:IHC-P, Human, Body glands.
-
Pathophysiology of reflux oesophagitis: role of Toll-like receptors 2 and 4 and Farnesoid X receptor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com