TLR4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant TLR4.
Immunogen
TLR4 (NP_612564, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag.
Sequence
PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.69 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TLR4
Entrez GeneID
7099GeneBank Accession#
NM_138554Protein Accession#
NP_612564Gene Name
TLR4
Gene Alias
ARMD10, CD284, TOLL, hToll
Gene Description
toll-like receptor 4
Omim ID
603030Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain. [provided by RefSeq
Other Designations
OTTHUMP00000022807|homolog of Drosophila toll
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Analysis of Mechanistic Pathway Models in Drug Discovery: p38 Pathway.
Hendriks BS, Hua F, Chabot JR.
Biotechnology Progress 2007 Oct; 24(1):96.
Application:WB, Human, U937 cells.
-
Analysis of Mechanistic Pathway Models in Drug Discovery: p38 Pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com