STAT2 monoclonal antibody (M01), clone 5G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STAT2 monoclonal antibody (M01), clone 5G7 Western Blot analysis of STAT2 expression in A-431 ( Cat # L015V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAT2 is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to STAT2 on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STAT2.
Immunogen
STAT2 (AAH51284, 742 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (33); Rat (50)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STAT2 monoclonal antibody (M01), clone 5G7 Western Blot analysis of STAT2 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAT2 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to STAT2 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — STAT2
Entrez GeneID
6773GeneBank Accession#
BC051284Protein Accession#
AAH51284Gene Name
STAT2
Gene Alias
ISGF-3, MGC59816, P113, STAT113
Gene Description
signal transducer and activator of transcription 2, 113kDa
Omim ID
600556Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. [provided by RefSeq
Other Designations
interferon alpha induced transcriptional activator|signal transducer and activator of transcription 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com