SMARCB1 monoclonal antibody (M01), clone 3E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMARCB1.
Immunogen
SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMARCB1 monoclonal antibody (M01), clone 3E10. Western Blot analysis of SMARCB1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
SMARCB1 monoclonal antibody (M01), clone 3E10. Western Blot analysis of SMARCB1 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
SMARCB1 monoclonal antibody (M01), clone 3E10 Western Blot analysis of SMARCB1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
SMARCB1 monoclonal antibody (M01), clone 3E10. Western Blot analysis of SMARCB1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMARCB1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — SMARCB1
Entrez GeneID
6598GeneBank Accession#
NM_003073Protein Accession#
NP_003064Gene Name
SMARCB1
Gene Alias
BAF47, INI1, RDT, SNF5, SNF5L1, Sfh1p, Snr1, hSNFS
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Omim ID
601607Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
integrase interactor 1|malignant rhabdoid tumor suppressor|sucrose nonfermenting, yeast, homolog-like 1
-
Interactome
-
Disease
-
Publication Reference
-
Distinct Pathogenic Genes Causing Intellectual Disability and Autism Exhibit a Common Neuronal Network Hyperactivity Phenotype.
Frega M, Selten M, Mossink B, Keller JM, Linda K, Moerschen R, Qu J, Koerner P, Jansen S, Oudakker A, Kleefstra T, van Bokhoven H, Zhou H, Schubert D, Nadif Kasri N.
Cell Reports 2020 Jan; 30(1):173.
Application:ICC, IF, Mouse, Primary neurons DIV21.
-
IGFBP7 Is Not Required for B-RAF-Induced Melanocyte Senescence.
Scurr LL, Pupo GM, Becker TM, Lai K, Schrama D, Haferkamp S, Irvine M, Scolyer RA, Mann GJ, Becker JC, Kefford RF, Rizos H.
Cell 2010 May; 141(4):717.
Application:WB-Ce, Human, Fibroblasts, Melanocytes.
-
Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7.
Narendra Wajapeyee, Ryan W Serra, Xiaochun Zhu, Meera Mahalingam, Michael R Green.
Cell 2008 Feb; 132(3):363.
Application:WB-Tr, Human, SK-MEL-28 cells.
-
Distinct Pathogenic Genes Causing Intellectual Disability and Autism Exhibit a Common Neuronal Network Hyperactivity Phenotype.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com