SHOX2 monoclonal antibody (M01J), clone 1D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SHOX2.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
SHOX2 (NP_006875, 117 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Host
Mouse
Reactivity
Human, Mouse, Rat
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SHOX2 monoclonal antibody (M01), clone 1D1. Western Blot analysis of SHOX2 expression in human liver.Western Blot (Cell lysate)
SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in PC-12.Western Blot (Cell lysate)
SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in HeLa.Western Blot (Cell lysate)
SHOX2 monoclonal antibody (M01J), clone 1D1. Western Blot analysis of SHOX2 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of SHOX2 expression in transfected 293T cell line by SHOX2 monoclonal antibody (M01J), clone 1D1.
Lane 1: SHOX2 transfected lysate (Predicted MW: 37.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SHOX2 is 0.1 ng/ml as a capture antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SHOX2 is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SHOX2 over-expressed 293 cell line, cotransfected with SHOX2 Validated Chimera RNAi ( Cat # H00006474-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SHOX2 monoclonal antibody (M01), clone 1D1 (Cat # H00006474-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — SHOX2
Entrez GeneID
6474GeneBank Accession#
NM_006884Protein Accession#
NP_006875Gene Name
SHOX2
Gene Alias
OG12, OG12X, OGI2X, SHOT
Gene Description
short stature homeobox 2
Omim ID
602504Gene Ontology
HyperlinkGene Summary
This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
SHOX homologous gene on chromosome 3|short stature homeobox homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com