RARA monoclonal antibody (M03), clone 2D2
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RARA.
Immunogen
RARA (NP_000955, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RARA is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — RARA
Entrez GeneID
5914GeneBank Accession#
NM_000964Protein Accession#
NP_000955Gene Name
RARA
Gene Alias
NR1B1, RAR
Gene Description
retinoic acid receptor, alpha
Omim ID
180240Gene Ontology
HyperlinkGene Summary
Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor (RXR; see MIM 180245), which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1 (MIM 600849), SMRT (NCOR2; MIM 600848), and histone deacetylase (see MIM 601241). When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases (see MIM 603053), and the basic transcription machinery. Translocations that always involve rearrangement of the RARA gene are a cardinal feature of acute promyelocytic leukemia (APL; MIM 612376). The most frequent translocation is t(15,17)(q21;q22), which fuses the RARA gene with the PML gene (MIM 102578) (Vitoux et al., 2007 [PubMed 17468032]).[supplied by OMIM
Other Designations
OTTHUMP00000164454|OTTHUMP00000164456|Retinoic acid receptor, alpha polypeptide|nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Moz and Retinoic Acid Coordinately Regulate H3K9 Acetylation, Hox Gene Expression, and Segment Identity.
Voss AK, Collin C, Dixon MP, Thomas T.
Developmental Cell 2009 Nov; 17(5):674.
Application:IF, IHC, Mouse, Mouse embryos.
-
Moz and Retinoic Acid Coordinately Regulate H3K9 Acetylation, Hox Gene Expression, and Segment Identity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com