PSMC6 monoclonal antibody (M02), clone 2C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PSMC6.
Immunogen
PSMC6 (AAH05390, 290 a.a. ~ 389 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PSMC6 monoclonal antibody (M02), clone 2C4 Western Blot analysis of PSMC6 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
PSMC6 monoclonal antibody (M02), clone 2C4. Western Blot analysis of PSMC6 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
PSMC6 monoclonal antibody (M02), clone 2C4. Western Blot analysis of PSMC6 expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PSMC6 expression in transfected 293T cell line by PSMC6 monoclonal antibody (M02), clone 2C4.
Lane 1: PSMC6 transfected lysate(44.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PSMC6 over-expressed 293 cell line, cotransfected with PSMC6 Validated Chimera RNAi ( Cat # H00005706-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMC6 monoclonal antibody (M02), clone 2C4 (Cat # H00005706-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to PSMC6 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PSMC6
Entrez GeneID
5706GeneBank Accession#
BC005390Protein Accession#
AAH05390Gene Name
PSMC6
Gene Alias
CADP44, MGC12520, P44, SUG2, p42
Gene Description
proteasome (prosome, macropain) 26S subunit, ATPase, 6
Omim ID
602708Gene Ontology
HyperlinkGene Summary
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq
Other Designations
26S protease regulatory subunit S10B|conserved ATPase domain protein 44|proteasome 26S ATPase subunit 6|proteasome subunit p42
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com