PCSK1 monoclonal antibody (M02), clone 3D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCSK1.
Immunogen
PCSK1 (NP_000430, 652 a.a. ~ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (84)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCSK1 monoclonal antibody (M02), clone 3D2. Western Blot analysis of PCSK1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
PCSK1 monoclonal antibody (M02), clone 3D2. Western Blot analysis of PCSK1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
PCSK1 monoclonal antibody (M02), clone 3D2 Western Blot analysis of PCSK1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
PCSK1 monoclonal antibody (M02), clone 3D2. Western Blot analysis of PCSK1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCSK1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PCSK1 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — PCSK1
Entrez GeneID
5122GeneBank Accession#
NM_000439Protein Accession#
NP_000430Gene Name
PCSK1
Gene Alias
BMIQ12, NEC1, PC1, PC3, SPC3
Gene Description
proprotein convertase subtilisin/kexin type 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a type I proinsulin-processing enzyme that plays a key role in regulating insulin biosynthesis. It is also known to cleave proopiomelanocortin, prorenin, proenkephalin, prodynorphin, prosomatostatin and progastrin. Mutations in this gene are thought to cause obesity. This encoded protein is associated with carcinoid tumors. The use of alternate polyadenylation sites has been found for this gene. Multiple alternatively spliced transcript variants have been described for this gene but their full length nature is not known. [provided by RefSeq
Other Designations
neuroendocrine convertase 1|prohormone convertase 1|prohormone convertase 3|proprotein convertase 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com