MEIS2 monoclonal antibody (M01), clone 1H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MEIS2.
Immunogen
MEIS2 (AAH01516, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (67.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MEIS2 monoclonal antibody (M01), clone 1H4. Western Blot analysis of MEIS2 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
MEIS2 monoclonal antibody (M01), clone 1H4 Western Blot analysis of MEIS2 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of MEIS2 expression in transfected 293T cell line by MEIS2 monoclonal antibody (M01), clone 1H4.
Lane 1: MEIS2 transfected lysate(51.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MEIS2 on formalin-fixed paraffin-embedded human spleen tissue. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MEIS2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MEIS2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MEIS2
Entrez GeneID
4212GeneBank Accession#
BC001516Protein Accession#
AAH01516Gene Name
MEIS2
Gene Alias
HsT18361, MGC2820, MRG1
Gene Description
Meis homeobox 2
Omim ID
601740Gene Ontology
HyperlinkGene Summary
This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq
Other Designations
Meis homolog 2|Meis1, myeloid ecotropic viral integration site 1 homolog 2|Meis1-related gene 1|OTTHUMP00000160209|TALE homeobox protein Meis2
-
Interactome
-
Disease
-
Publication Reference
-
Comparative analyses of the Smith-Magenis syndrome protein RAI1 in mice and common marmoset monkeys.
Ya-Ting Chang, Yu-Ju Lee, Minza Haque, Hao-Cheng Chang, Sehrish Javed, Yu Cheng Lin, Yoobin Cho, Joseph Abramovitz, Gabriella Chin, Asma Khamis, Reesha Raja, Keith K Murai, Wei-Hsiang Huang.
The Journal of Comparative Neurology 2024 Jan; 532(1):e25589.
Application:ICC, Marmoset, Brain tissue.
-
Structure of the DDB1-CRBN E3 ubiquitin ligase in complex with thalidomide.
Fischer ES, Bohm K, Lydeard JR, Yang H, Stadler MB, Cavadini S, Nagel J, Serluca F, Acker V, Lingaraju GM, Tichkule RB, Schebesta M, Forrester WC, Schirle M, Hassiepen U, Ottl J, Hild M, Beckwith RE, Harper JW, Jenkins JL, Thoma NH.
Nature 2014 Aug; 512(7512):49.
Application:WB-Ce, Human, HEK293T cells.
-
Cooperative transcriptional activation by klf4, meis2, and pbx1.
Bjerke GA, Hyman-Walsh C, Wotton D.
Molecular and Cellular Biology 2011 Sep; 31(18):3723.
Application:WB-Tr, Monkey, COS-1 cells.
-
A neuronal migratory pathway crossing from diencephalon to telencephalon populates amygdala nuclei.
Garcia-Moreno F, Pedraza M, Di Giovannantonio LG, Di Salvio M, Lopez-Mascaraque L, Simeone A, De Carlos JA.
Nature Neuroscience 2010 Jun; 13(6):680.
Application:IF, IHC, Mouse, Embryos, Hypothalamus.
-
Comparative analyses of the Smith-Magenis syndrome protein RAI1 in mice and common marmoset monkeys.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com