SMAD3 monoclonal antibody (M02), clone 7F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMAD3.
Immunogen
SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in human colon.Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in HeLa.Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in 293 ( Cat # L026V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M02), clone 7F3.
Lane 1: SMAD3 transfected lysate(48 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SMAD3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMAD3 is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPK8 and SMAD3. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-SMAD3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — SMAD3
Entrez GeneID
4088GeneBank Accession#
NM_005902Protein Accession#
NP_005893Gene Name
SMAD3
Gene Alias
DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396
Gene Description
SMAD family member 3
Omim ID
603109Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq
Other Designations
MAD, mothers against decapentaplegic homolog 3|SMA- and MAD-related protein 3|SMAD, mothers against DPP homolog 3|mad homolog JV15-2|mad protein homolog|mothers against decapentaplegic homolog 3
-
Interactome
-
Pathway
-
Disease
- Alzheimer disease
- Anemia
- Asthma
- Bacteremia
- Breast cancer
- Breast Neoplasms
- Cleft Lip
- Cleft Palate
- Coronary Artery Disease
+ View More Disease
-
Publication Reference
-
Ectopic Expression of Homeobox Gene NKX2-1 in Diffuse Large B-Cell Lymphoma Is Mediated by Aberrant Chromatin Modifications.
Nagel S, Ehrentraut S, Tomasch J, Quentmeier H, Meyer C, Kaufmann M, Drexler HG, Macleod RA.
PLoS One 2013 Apr; 8(4):e61447.
Application:IF, Human, SU-DHL-5 cells.
-
Ectopic Expression of Homeobox Gene NKX2-1 in Diffuse Large B-Cell Lymphoma Is Mediated by Aberrant Chromatin Modifications.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com