SMAD3 monoclonal antibody (M01A), clone 2C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMAD3.
Immunogen
SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SMAD3 monoclonal antibody (M01A), clone 2C12. Western Blot analysis of SMAD3 expression in human colon.Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M01A), clone 2C12. Western Blot analysis of SMAD3 expression in Hs 181.Tes.Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M01A), clone 2C12. Western Blot analysis of SMAD3 expression in HeLa.Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M01A), clone 2C12. Western Blot analysis of SMAD3 expression in U-2 OS ( Cat # L022V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M01A), clone 2C12.
Lane 1: SMAD3 transfected lysate(48 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SMAD3
Entrez GeneID
4088GeneBank Accession#
NM_005902Protein Accession#
NP_005893Gene Name
SMAD3
Gene Alias
DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396
Gene Description
SMAD family member 3
Omim ID
603109Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq
Other Designations
MAD, mothers against decapentaplegic homolog 3|SMA- and MAD-related protein 3|SMAD, mothers against DPP homolog 3|mad homolog JV15-2|mad protein homolog|mothers against decapentaplegic homolog 3
-
Interactome
-
Pathway
-
Disease
- Alzheimer disease
- Anemia
- Asthma
- Bacteremia
- Breast cancer
- Breast Neoplasms
- Cleft Lip
- Cleft Palate
- Coronary Artery Disease
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com