CYP2D6 monoclonal antibody (M07), clone 2C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CYP2D6.
Immunogen
CYP2D6 (NP_000097, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (69)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYP2D6 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — CYP2D6
Entrez GeneID
1565GeneBank Accession#
NG_003180Protein Accession#
NP_000097Gene Name
CYP2D6
Gene Alias
CPD6, CYP2D, CYP2D@, CYP2DL1, MGC120389, MGC120390, P450-DB1, P450C2D, P450DB1
Gene Description
cytochrome P450, family 2, subfamily D, polypeptide 6
Omim ID
124030Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
cytochrome P450 2D6|cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6|cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1|debrisoquine 4-hydroxylase|flavoprotein-linked monooxygen
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com