CDK2 monoclonal antibody (M02), clone 2E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDK2.
Immunogen
CDK2 (AAH03065, 211 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDK2 monoclonal antibody (M02), clone 2E8. Western Blot analysis of CDK2 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
CDK2 monoclonal antibody (M02), clone 2E8 Western Blot analysis of CDK2 expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody (M02), clone 2E8.
Lane 1: CDK2 transfected lysate(33.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDK2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi ( Cat # H00001017-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody (M02) clone 2E8 (Cat # H00001017-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CDK2
Entrez GeneID
1017GeneBank Accession#
BC003065Protein Accession#
AAH03065Gene Name
CDK2
Gene Alias
p33(CDK2)
Gene Description
cyclin-dependent kinase 2
Omim ID
116953Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein kinase is highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of the cyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycle G1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its protein phosphorylation. Two alternatively spliced variants and multiple transcription initiation sites of this gene have been reported. [provided by RefSeq
Other Designations
cdc2-related protein kinase|cell devision kinase 2|p33 protein kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com