CCNB1 monoclonal antibody (M01), clone 1C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CCNB1.
Immunogen
CCNB1 (NP_114172, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (69)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CCNB1 monoclonal antibody (M01), clone 1C8 Western Blot analysis of CCNB1 expression in JAR ( Cat # L003V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CCNB1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCNB1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CCNB1
Entrez GeneID
891GeneBank Accession#
NM_031966Protein Accession#
NP_114172Gene Name
CCNB1
Gene Alias
CCNB
Gene Description
cyclin B1
Omim ID
123836Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites. [provided by RefSeq
Other Designations
G2/mitotic-specific cyclin B1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Ilamycin E, a natural product of marine actinomycete, inhibits triple-negative breast cancer partially through ER stress-CHOP-Bcl-2.
Zhou W, Fang H, Wu Q, Wang X, Liu R, Li F, Xiao J, Yuan L, Zhou Z, Ma J, Wang L, Zhao W, You H, Ju J, Feng J, Chen C.
International Journal of Biological Sciences 2019 Jun; 15(8):1723.
Application:WB-Ce, Human, HCC1937, MDA-MB-468 cells.
-
Ilamycin E, a natural product of marine actinomycete, inhibits triple-negative breast cancer partially through ER stress-CHOP-Bcl-2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com