CAPNS1 monoclonal antibody (M01), clone 3C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CAPNS1.
Immunogen
CAPNS1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CAPNS1 monoclonal antibody (M01), clone 3C4. Western Blot analysis of CAPNS1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
CAPNS1 monoclonal antibody (M01), clone 3C4 Western Blot analysis of CAPNS1 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CAPNS1 expression in transfected 293T cell line by CAPNS1 monoclonal antibody (M01), clone 3C4.
Lane 1: CAPNS1 transfected lysate(28.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CAPNS1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAPNS1 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CAPNS1 over-expressed 293 cell line, cotransfected with CAPNS1 Validated Chimera RNAi ( Cat # H00000826-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPNS1 monoclonal antibody (M01), clone 3C4 (Cat # H00000826-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to CAPNS1 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — CAPNS1
Entrez GeneID
826GeneBank Accession#
BC000592Protein Accession#
AAH00592Gene Name
CAPNS1
Gene Alias
30K, CALPAIN4, CANP, CANPS, CAPN4, CDPS
Gene Description
calpain, small subunit 1
Omim ID
114170Gene Ontology
HyperlinkGene Summary
Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
calcium-activated neutral proteinase|calcium-dependent protease, small subunit|calpain 4, small subunit (30K)|calpain, small polypeptide
-
Interactome
-
Disease
-
Publication Reference
-
Genetic Models of Calpain Deficiency and Ectopic Expression.
Gao Y, Hall C, MacLeod J, Greer PA.
Methods in Molecular Biology (Clifton, N.J.) 2019 Jan; 1915:261.
Application:WB, Human, MDA-MB-231 cells.
-
FK506-binding protein 10 (FKBP10) regulates lung fibroblast migration via collagen VI synthesis.
Knüppel L, Heinzelmann K, Lindner M, Hatz R, Behr J, Eickelberg O, Staab-Weijnitz CA.
Respiratory Research 2018 Apr; 19(1):67.
Application:IF, PLA, WB, Human, Primary human lung fibroblasts.
-
Overexpression of a Minimal Domain of Calpastatin Suppresses IL-6 Production and Th17 Development via Reduced NF-kB and Increased STAT5 Signals.
Iguchi-Hashimoto M, Usui T, Yoshifuji H, Shimizu M, Kobayashi S, Ito Y, Murakami K, Shiomi A, Yukawa N, Kawabata D, Nojima T, Ohmura K, Fujii T, Mimori T.
PLoS One 2011 Oct; 6(10):e27020.
Application:WB-Tr, Mouse, Naïve CD4+ T cells.
-
The calpain inhibitor calpeptin prevents bleomycin-induced pulmonary fibrosis in mice.
Tabata C, Tabata R, Nakano T.
Clinical and Experimental Immunology 2010 Dec; 162(3):560.
Application:IHC, Mouse, Mouse lungs.
-
Vitamin E and C supplementation does not ameliorate muscle dysfunction following anterior cruciate ligament surgery.
Barker T, Leonard SW, Hansen J, Trawick RH, Ingram R, Burdett G, Lebold KM, Walker JA, Traber MG.
Free Radical Biology & Medicine 2009 Dec; 47(11):1611.
Application:IHC-P, Human, Human muscle biopsies.
-
Genetic Models of Calpain Deficiency and Ectopic Expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com