ATP6V1G2 monoclonal antibody (M02), clone 2E11

Catalog # H00000534-M02

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in NIH/3T3 ( Cat # L018V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in Raw 264.7 ( Cat # L024V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ATP6V1G2 monoclonal antibody (M02), clone 2E11 Western Blot analysis of ATP6V1G2 expression in HepG2 ( Cat # L019V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody (M02), clone 2E11.

Lane 1: ATP6V1G2 transfected lysate(13.6 KDa).
Lane 2: Non-transfected lysate.

QC Test

Western Blot detection against Immunogen (34.32 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant ATP6V1G2.

    Immunogen

    ATP6V1G2 (NP_569730, 41 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Isotype

    IgG2b Lambda

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (34.32 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in NIH/3T3 ( Cat # L018V1 ).

    Western Blot (Cell lysate)

    ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in Raw 264.7 ( Cat # L024V1 ).

    Western Blot (Cell lysate)

    ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    ATP6V1G2 monoclonal antibody (M02), clone 2E11 Western Blot analysis of ATP6V1G2 expression in HepG2 ( Cat # L019V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody (M02), clone 2E11.

    Lane 1: ATP6V1G2 transfected lysate(13.6 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    ELISA

  • Gene Info — ATP6V1G2

    Entrez GeneID

    534

    GeneBank Accession#

    NM_130463

    Protein Accession#

    NP_569730

    Gene Name

    ATP6V1G2

    Gene Alias

    ATP6G, ATP6G2, NG38, VMA10

    Gene Description

    ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2

    Omim ID

    606853

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq

    Other Designations

    ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G|ATPase, H+ transporting, lysosomal, V1 subunit G2|H(+)-transporting two-sector ATPase, subunit G2|OTTHUMP00000029286|OTTHUMP00000036058|OTTHUMP00000036060|V-ATPase 13 kDa subunit 2|V-ATPa

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All