ASPA MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in human liver.
Western Blot (Tissue lysate)
ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in mouse liver.
Western Blot (Transfected lysate)
Western Blot analysis of ASPA expression in transfected 293T cell line (H00000443-T01) by ASPA MaxPab polyclonal antibody.
Lane 1: ASPA transfected lysate(35.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ASPA transfected lysate using anti-ASPA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ASPA purified MaxPab mouse polyclonal antibody (B01P) (H00000443-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ASPA protein.
Immunogen
ASPA (NP_000040.1, 1 a.a. ~ 313 a.a) full-length human protein.
Sequence
MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in human liver.Western Blot (Tissue lysate)
ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of ASPA expression in transfected 293T cell line (H00000443-T01) by ASPA MaxPab polyclonal antibody.
Lane 1: ASPA transfected lysate(35.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ASPA transfected lysate using anti-ASPA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ASPA purified MaxPab mouse polyclonal antibody (B01P) (H00000443-B01P). -
Gene Info — ASPA
Entrez GeneID
443GeneBank Accession#
NM_000049.2Protein Accession#
NP_000040.1Gene Name
ASPA
Gene Alias
ACY2, ASP
Gene Description
aspartoacylase (Canavan disease)
Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
aminoacylase 2|aspartoacylase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com