ACTN4 monoclonal antibody (M01A), clone 4D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACTN4.
Immunogen
ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01A), clone 4D10 Western Blot analysis of ACTN4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01A), clone 4D10.
Lane 1: ACTN4 transfected lysate(104.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — ACTN4
Entrez GeneID
81GeneBank Accession#
NM_004924Protein Accession#
NP_004915Gene Name
ACTN4
Gene Alias
ACTININ-4, DKFZp686K23158, FSGS, FSGS1
Gene Description
actinin, alpha 4
Gene Ontology
HyperlinkGene Summary
Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis. [provided by RefSeq
Other Designations
actinin alpha4 isoform
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com