TWIST1 monoclonal antibody (M01), clone 3E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant TWIST1.
Immunogen
TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TWIST1 monoclonal antibody (M01), clone 3E11. Western Blot analysis of TWIST1 expression in rat testis.Western Blot (Transfected lysate)
Western Blot analysis of TWIST1 expression in transfected 293T cell line by TWIST1 monoclonal antibody (M01), clone 3E11.
Lane 1: TWIST1 transfected lysate(21 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TWIST1 MaxPab rabbit polyclonal antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TWIST1 over-expressed 293 cell line, cotransfected with TWIST1 Validated Chimera RNAi ( Cat # H00007291-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TWIST1 monoclonal antibody (M01), clone 3E11 (Cat # H00007291-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TWIST1
Entrez GeneID
7291GeneBank Accession#
NM_000474Protein Accession#
NP_000465Gene Name
TWIST1
Gene Alias
ACS3, BPES2, BPES3, SCS, TWIST, bHLHa38
Gene Description
twist homolog 1 (Drosophila)
Gene Ontology
HyperlinkGene Summary
Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. [provided by RefSeq
Other Designations
B-HLH DNA binding protein|H-twist|TWIST homolog of drosophila|twist
-
Interactomes
-
Diseases
-
Publication Reference
-
Hsp90β promotes aggressive vasculogenic mimicry via epithelial-mesenchymal transition in hepatocellular carcinoma.
Meng J, Chen S, Lei YY, Han JX, Zhong WL, Wang XR, Liu YR, Gao WF, Zhang Q, Tan Q, Liu HJ, Zhou HG, Sun T, Yang C.
Oncogene 2018 Aug; [Epub].
Application:IF, IP-WB, WB-Tr, Human, PLC-PRF-5, SMMC-7721 cells.
-
Notch1 regulates the initiation of metastasis and self-renewal of Group 3 medulloblastoma.
Kahn SA, Wang X, Nitta RT, Gholamin S, Theruvath J, Hutter G, Azad TD, Wadi L, Bolin S, Ramaswamy V, Esparza R, Liu KW, Edwards M, Swartling FJ, Sahoo D, Li G, Wechsler-Reya RJ, Reimand J, Cho YJ, Taylor MD, Weissman IL, Mitra SS, Cheshier SH.
Nature Communications 2018 Oct; 9(1):4121.
Application:WB, Human, D425 cells.
-
Cellular migration and invasion uncoupled: Increased migration is not an inexorable consequence of EMT.
Schaeffer D, Somarelli JA, Hanna G, Palmer GM, Garcia-Blanco MA.
Molecular and Cellular Biology 2014 Sep; 34(18):3486.
Application:IF, Human, HMLE-TWIST1 cells.
-
EMT and induction of miR-21 mediate metastasis development in Trp53-deficient tumours.
Bornachea O, Santos M, Martínez-Cruz AB, García-Escudero R, Dueñas M, Costa C, Segrelles C, Lorz C, Buitrago A, Saiz-Ladera C, Agirre X, Grande T, Paradela B, Maraver A, Ariza JM, Prosper F, Serrano M, Sánchez-Céspedes M, Paramio JM.
Scientific Reports 2012 May; 2:434.
Application:WB, Human, PB cells.
-
Conversion of Helicobacter pylori CagA from senescence inducer to oncogenic driver through polarity-dependent regulation of p21.
Saito Y, Murata-Kamiya N, Hirayama T, Ohba Y, Hatakeyama M.
The Journal of Experimental Medicine 2010 Sep; 207(10):2157.
Application:WB-Ce, Dog, MDCK-WT-CagA cells.
-
Hsp90β promotes aggressive vasculogenic mimicry via epithelial-mesenchymal transition in hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com