SMAD3 monoclonal antibody (M07), clone 1B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMAD3.
Immunogen
SMAD3 (NP_005893, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCE
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M07), clone 1B7 Western Blot analysis of SMAD3 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M07), clone 1B7.
Lane 1: SMAD3 transfected lysate(48 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMAD3 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — SMAD3
Entrez GeneID
4088GeneBank Accession#
NM_005902Protein Accession#
NP_005893Gene Name
SMAD3
Gene Alias
DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396
Gene Description
SMAD family member 3
Omim ID
603109Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq
Other Designations
MAD, mothers against decapentaplegic homolog 3|SMA- and MAD-related protein 3|SMAD, mothers against DPP homolog 3|mad homolog JV15-2|mad protein homolog|mothers against decapentaplegic homolog 3
-
Interactome
-
Pathway
-
Disease
- Alzheimer disease
- Anemia
- Asthma
- Bacteremia
- Breast cancer
- Breast Neoplasms
- Cleft Lip
- Cleft Palate
- Coronary Artery Disease
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com