Product Browser

Last updated: 2015/3/22
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TWIST1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00007291-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human TWIST1 protein.
  • Immunogen:
  • TWIST1 (NP_000465.1, 1 a.a. ~ 202 a.a) full-length human protein.
  • Sequence:
  • MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TWIST1 expression in transfected 293T cell line (H00007291-T03) by TWIST1 MaxPab polyclonal antibody.

    Lane 1: TWIST1 transfected lysate(21.00 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 7291
  • Gene Name:
  • TWIST1
  • Gene Alias:
  • ACS3,BPES2,BPES3,SCS,TWIST,bHLHa38
  • Gene Description:
  • twist homolog 1 (Drosophila)
  • Gene Summary:
  • Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. [provided by RefSeq
  • Other Designations:
  • B-HLH DNA binding protein,H-twist,TWIST homolog of drosophila,twist
  • RSS
  • YouTube
  • Linkedin
  • Facebook