Product Browser

Last updated: 2014/4/14

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

ATP2A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000487-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP2A1 partial ORF ( NP_775293, 522 a.a. - 612 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.75
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000487-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 487
  • Gene Name:
  • ATP2A1
  • Gene Alias:
  • ATP2A,SERCA1
  • Gene Description:
  • ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
  • Gene Summary:
  • This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • ATPase, Ca++ transporting, fast twitch 1,OTTHUMP00000162562,SR Ca(2+)-ATPase 1,calcium pump 1,calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform,endoplasmic reticulum class 1/2 Ca(2+) ATPase,sarcoplasmic/endoplasm
  • RSS
  • YouTube
  • Linkedin
  • Facebook