Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PARK7 polyclonal antibody (A01)

  • Catalog # : H00011315-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PARK7.
  • Immunogen:
  • PARK7 (AAH08188, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011315-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PARK7 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of PARK7 expression in Y-79 ( Cat # L042V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PARK7
  • Gene Alias:
  • DJ-1,DJ1,FLJ27376,FLJ34360,FLJ92274
  • Gene Description:
  • Parkinson disease (autosomal recessive, early onset) 7
  • Gene Summary:
  • The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000001348,OTTHUMP00000001349,OTTHUMP00000001350,OTTHUMP00000001351,Parkinson disease protein 7,oncogene DJ1,protein DJ-1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook