ROCK2 monoclonal antibody (M02), clone 1E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ROCK2.
Immunogen
ROCK2 (NP_004841, 1279 a.a. ~ 1388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ROCK2 monoclonal antibody (M02), clone 1E12 Western Blot analysis of ROCK2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ROCK2 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — ROCK2
Entrez GeneID
9475GeneBank Accession#
NM_004850Protein Accession#
NP_004841Gene Name
ROCK2
Gene Alias
KIAA0619
Gene Description
Rho-associated, coiled-coil containing protein kinase 2
Omim ID
604002Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho. [provided by RefSeq
Other Designations
OTTHUMP00000195104
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Identification of Homoharringtonine as a potent inhibitor of glioblastoma cell proliferation and migration.
Elena Porcù, Francesca Maule, Lorenzo Manfreda, Elena Mariotto, Silvia Bresolin, Alice Cani, Roberta Bortolozzi, Alessandro Della Puppa, Diana Corallo, Giampietro Viola, Elena Rampazzo, Luca Persano.
Translational Research 2023 Jan; 251:41.
Application:WB, Human, primary glioblastoma cells.
-
Aortic smooth muscle cell alterations in mice systemically exposed to arsenic.
Chen SC, Huang SY, Lin WT, Yang RC, Yu HS.
Heart and Vessels 2016 May; 31(5):807.
Application:WB, Mouse, Mouse aortic tissues.
-
Vascular hyperpermeability in response to inflammatory mustard oil is mediated by Rho kinase in mice systemically exposed to arsenic.
Chen SC, Liu CC, Huang SY, Chiou SJ.
Microvasc Res 2011 Jun; 82:182.
Application:WB-Ti, Mouse, Ear.
-
Identification of Homoharringtonine as a potent inhibitor of glioblastoma cell proliferation and migration.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com