STK4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant STK4.
Immunogen
STK4 (NP_006273, 391 a.a. ~ 485 a.a) partial recombinant protein with GST tag.
Sequence
AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.56 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STK4 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of STK4 expression in Raw 264.7.Western Blot (Cell lysate)
STK4 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of STK4 expression in NIH/3T3.Western Blot (Cell lysate)
STK4 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of STK4 expression in PC-12.Western Blot (Cell lysate)
STK4 polyclonal antibody (A01), Lot # 060707JCS1 Western Blot analysis of STK4 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — STK4
Entrez GeneID
6789GeneBank Accession#
NM_006282Protein Accession#
NP_006273Gene Name
STK4
Gene Alias
DKFZp686A2068, KRS2, MST1, YSK3
Gene Description
serine/threonine kinase 4
Omim ID
604965Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process. [provided by RefSeq
Other Designations
OTTHUMP00000043418|dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2))|kinase responsive to stress 2|mammalian sterile 20-like 1|yeast Ste20-like
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com