Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STK4 polyclonal antibody (A01)

  • Catalog # : H00006789-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant STK4.
  • Immunogen:
  • STK4 (NP_006273, 391 a.a. ~ 485 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006789-A01
    Western Blot detection against Immunogen (36.56 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STK4 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of STK4 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STK4 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of STK4 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STK4 polyclonal antibody (A01), Lot # 060707JCS1 Western Blot analysis of STK4 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STK4 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of STK4 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6789
  • Gene Name:
  • STK4
  • Gene Alias:
  • DKFZp686A2068,KRS2,MST1,YSK3
  • Gene Description:
  • serine/threonine kinase 4
  • Gene Summary:
  • The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000043418,dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2)),kinase responsive to stress 2,mammalian sterile 20-like 1,yeast Ste20-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook