STK4 monoclonal antibody (M02), clone 4F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STK4 monoclonal antibody (M02), clone 4F4. Western Blot analysis of STK4 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
STK4 monoclonal antibody (M02), clone 4F4. Western Blot analysis of STK4 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
STK4 monoclonal antibody (M02), clone 4F4. Western Blot analysis of STK4 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
STK4 monoclonal antibody (M02), clone 4F4 Western Blot analysis of STK4 expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK4 is approximately 0.1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and STK4. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-STK4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to STK4 on HeLa cell. [antibody concentration 25 ug/ml]
Western Blot detection against Immunogen (36.19 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STK4.
Immunogen
STK4 (NP_006273, 391 a.a. ~ 485 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STK4 monoclonal antibody (M02), clone 4F4. Western Blot analysis of STK4 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
STK4 monoclonal antibody (M02), clone 4F4. Western Blot analysis of STK4 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
STK4 monoclonal antibody (M02), clone 4F4. Western Blot analysis of STK4 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
STK4 monoclonal antibody (M02), clone 4F4 Western Blot analysis of STK4 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK4 is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and STK4. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-STK4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to STK4 on HeLa cell. [antibody concentration 25 ug/ml] -
Gene Info — STK4
Entrez GeneID
6789GeneBank Accession#
NM_006282Protein Accession#
NP_006273Gene Name
STK4
Gene Alias
DKFZp686A2068, KRS2, MST1, YSK3
Gene Description
serine/threonine kinase 4
Omim ID
604965Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process. [provided by RefSeq
Other Designations
OTTHUMP00000043418|dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2))|kinase responsive to stress 2|mammalian sterile 20-like 1|yeast Ste20-like
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com