Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAD2L1 polyclonal antibody (A01)

  • Catalog # : H00004085-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant MAD2L1.
  • Immunogen:
  • MAD2L1 (AAH00356, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004085-A01
    Western Blot detection against Immunogen (48.66 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4085
  • Gene Name:
  • MAD2L1
  • Gene Alias:
  • HSMAD2,MAD2
  • Gene Description:
  • MAD2 mitotic arrest deficient-like 1 (yeast)
  • Gene Summary:
  • MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq
  • Other Designations:
  • MAD2 (mitotic arrest deficient, yeast, homolog)-like 1,MAD2-like 1,MAD2-like protein 1,mitotic arrest deficient, yeast, homolog-like 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook