MAD2L1 monoclonal antibody (M01), clone 2E2-1D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MAD2L1 monoclonal antibody (M01), clone 2E2-1D6 Western Blot analysis of MAD2L1 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of MAD2L1 expression in transfected 293T cell line by MAD2L1 monoclonal antibody (M01), clone 2E2-1D6.
Lane 1: MAD2L1 transfected lysate(23.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAD2L1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (48.29 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MAD2L1.
Immunogen
MAD2L1 (AAH00356, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Host
Mouse
Reactivity
Human
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAD2L1 monoclonal antibody (M01), clone 2E2-1D6 Western Blot analysis of MAD2L1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of MAD2L1 expression in transfected 293T cell line by MAD2L1 monoclonal antibody (M01), clone 2E2-1D6.
Lane 1: MAD2L1 transfected lysate(23.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAD2L1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — MAD2L1
Entrez GeneID
4085GeneBank Accession#
BC000356Protein Accession#
AAH00356Gene Name
MAD2L1
Gene Alias
HSMAD2, MAD2
Gene Description
MAD2 mitotic arrest deficient-like 1 (yeast)
Omim ID
601467Gene Ontology
HyperlinkGene Summary
MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq
Other Designations
MAD2 (mitotic arrest deficient, yeast, homolog)-like 1|MAD2-like 1|MAD2-like protein 1|mitotic arrest deficient, yeast, homolog-like 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
RED, a spindle pole-associated protein, is required for kinetochore localization of MAD1, mitotic progression, and activation of the spindle assembly checkpoint.
Yeh PC, Yeh CC, Chen YC, Juang YL.
The Journal of Biological Chemistry 2012 Apr; 287(15):11704.
Application：WB-Ce, Human, HeLa cells.
-
RED, a spindle pole-associated protein, is required for kinetochore localization of MAD1, mitotic progression, and activation of the spindle assembly checkpoint.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com