HDAC2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HDAC2 expression in transfected 293T cell line (H00003066-T02) by HDAC2 MaxPab polyclonal antibody.
Lane 1: HDAC2 transfected lysate(64.02 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HDAC2 and PPARD. HeLa cells were stained with anti-HDAC2 rabbit purified polyclonal 1:1200 and anti-PPARD mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HDAC2 on HeLa cell. [antibody concentration 30 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HDAC2 protein.
Immunogen
HDAC2 (AAI48798.1, 1 a.a. ~ 582 a.a) full-length human protein.
Sequence
MRSPPCGLLRWFGGPLLASWCRCHLRFRAFGTSAGWYRAFPAPPPLLPPACPSPRDYRPHVSLSPFLSRPSRGGSSSSSSSRRRSPVAAVAGEPMAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HDAC2 expression in transfected 293T cell line (H00003066-T02) by HDAC2 MaxPab polyclonal antibody.
Lane 1: HDAC2 transfected lysate(64.02 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HDAC2 and PPARD. HeLa cells were stained with anti-HDAC2 rabbit purified polyclonal 1:1200 and anti-PPARD mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HDAC2 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — HDAC2
Entrez GeneID
3066GeneBank Accession#
BC148797Protein Accession#
AAI48798.1Gene Name
HDAC2
Gene Alias
RPD3, YAF1
Gene Description
histone deacetylase 2
Omim ID
605164Gene Ontology
HyperlinkGene Summary
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes and are responsible for the deacetylation of lysine residues on the N-terminal region of the core histones (H2A, H2B, H3 and H4). This protein also forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus it plays an important role in transcriptional regulation, cell cycle progression and developmental events. [provided by RefSeq
Other Designations
OTTHUMP00000040427|YY1-associated factor 1|transcriptional regulator homolog RPD3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com