HDAC2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis with HDAC2 polyclonal antibody (Cat # PAB30581).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot
Western Blot analysis with HDAC2 polyclonal antibody (Cat # PAB30581).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissue
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with HDAC2 polyclonal antibody (Cat # PAB30581) shows strong nuclear and cytoplasmic positivity in neuronal cells.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with HDAC2 polyclonal antibody (Cat # PAB30581) shows positivity in nucleus. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human HDAC2.
Immunogen
Recombinant protein corresponding to amino acids 415-488 of human HDAC2.
Sequence
IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with HDAC2 polyclonal antibody (Cat # PAB30581).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Western Blot
Western Blot analysis with HDAC2 polyclonal antibody (Cat # PAB30581).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissueImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with HDAC2 polyclonal antibody (Cat # PAB30581) shows strong nuclear and cytoplasmic positivity in neuronal cells.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with HDAC2 polyclonal antibody (Cat # PAB30581) shows positivity in nucleus. Antibody staining is shown in green. -
Gene Info — HDAC2
Entrez GeneID
3066Protein Accession#
Q92769Gene Name
HDAC2
Gene Alias
RPD3, YAF1
Gene Description
histone deacetylase 2
Omim ID
605164Gene Ontology
HyperlinkGene Summary
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes and are responsible for the deacetylation of lysine residues on the N-terminal region of the core histones (H2A, H2B, H3 and H4). This protein also forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus it plays an important role in transcriptional regulation, cell cycle progression and developmental events. [provided by RefSeq
Other Designations
OTTHUMP00000040427|YY1-associated factor 1|transcriptional regulator homolog RPD3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com