PARK7 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PARK7.
Immunogen
PARK7 (AAH08188, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Sequence
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PARK7 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of PARK7 expression in Y-79 ( Cat # L042V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PARK7
Entrez GeneID
11315GeneBank Accession#
BC008188Protein Accession#
AAH08188Gene Name
PARK7
Gene Alias
DJ-1, DJ1, FLJ27376, FLJ34360, FLJ92274
Gene Description
Parkinson disease (autosomal recessive, early onset) 7
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000001348|OTTHUMP00000001349|OTTHUMP00000001350|OTTHUMP00000001351|Parkinson disease protein 7|oncogene DJ1|protein DJ-1
-
Interactome
-
Disease
-
Publication Reference
-
Flexible platinum electrodes as electrochemical sensor and immunosensor for Parkinson's disease biomarkers.
Gabriela C Mauruto de Oliveira, Jefferson Henrique de Souza Carvalho, Laís Canniatti Brazaca, Nirton Cristi Silva Vieira, Bruno Campos Janegitz.
Biosensors & Bioelectronics 2020 Mar; 152:112016.
Application:Func, Synthetic urine samples.
-
A simple cell based assay to measure Parkin activity.
Morrison E, Thompson J, Williamson SJ, Cheetham ME, Robinson PA.
Journal of Neurochemistry 2010 Nov; 116(3).
Application:WB, Human, HEK 293T.
-
Flexible platinum electrodes as electrochemical sensor and immunosensor for Parkinson's disease biomarkers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com