ABL2 monoclonal antibody (M05), clone 3D2
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ABL2.
Immunogen
ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody (M05), clone 3D2.
Lane 1: ABL2 transfected lysate(127 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ABL2
Entrez GeneID
27GeneBank Accession#
BC065912Protein Accession#
AAH65912Gene Name
ABL2
Gene Alias
ABLL, ARG, FLJ22224, FLJ31718, FLJ41441
Gene Description
v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
Omim ID
164690Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq
Other Designations
Abelson murine leukemia viral (v-abl) oncogene homolog 2|Abelson-related gene protein|OTTHUMP00000033139|arg tyrosine kinase|v-abl Abelson murine leukemia viral oncogene homolog 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com