CBX3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with CBX3 polyclonal antibody (Cat # PAB30722).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with CBX3 polyclonal antibody (Cat # PAB30722) shows distinct nuclear positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG with CBX3 polyclonal antibody (Cat # PAB30722) (Green) shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CBX3.
Immunogen
Recombinant protein corresponding to human CBX3.
Sequence
RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with CBX3 polyclonal antibody (Cat # PAB30722).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with CBX3 polyclonal antibody (Cat # PAB30722) shows distinct nuclear positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of U-251 MG with CBX3 polyclonal antibody (Cat # PAB30722) (Green) shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — CBX3
Entrez GeneID
11335Protein Accession#
Q13185Gene Name
CBX3
Gene Alias
HECH, HP1-GAMMA, HP1Hs-gamma
Gene Description
chromobox homolog 3 (HP1 gamma homolog, Drosophila)
Omim ID
604477Gene Ontology
HyperlinkGene Summary
At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene. [provided by RefSeq
Other Designations
HP1 gamma homolog|OTTHUMP00000024529|OTTHUMP00000122519|chromobox homolog 3|heterochromatin protein HP1 gamma|heterochromatin-like protein 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com