CBX3 monoclonal antibody (M01), clone 1G12-1D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CBX3 monoclonal antibody (M01), clone 1G12-1D9 Western Blot analysis of CBX3 expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBX3 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CBX3 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (45.87 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CBX3.
Immunogen
CBX3 (AAH00954, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CBX3 monoclonal antibody (M01), clone 1G12-1D9 Western Blot analysis of CBX3 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBX3 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CBX3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CBX3
Entrez GeneID
11335GeneBank Accession#
BC000954Protein Accession#
AAH00954Gene Name
CBX3
Gene Alias
HECH, HP1-GAMMA, HP1Hs-gamma
Gene Description
chromobox homolog 3 (HP1 gamma homolog, Drosophila)
Omim ID
604477Gene Ontology
HyperlinkGene Summary
At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene. [provided by RefSeq
Other Designations
HP1 gamma homolog|OTTHUMP00000024529|OTTHUMP00000122519|chromobox homolog 3|heterochromatin protein HP1 gamma|heterochromatin-like protein 1
-
Interactome
-
Publication Reference
-
DNA Topoisomerase III Alpha Regulates p53-Mediated Tumor Suppression.
Hsieh MY, Fan JR, Chang HW, Chen HC, Shen TL, Teng SC, Yeh YH, Li TK.
Clinical Cancer Research 2014 Mar; 20(6):1489.
-
Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.
Lin TY, Cheng YC, Yang HC, Lin WC, Wang CC, Lai PL, Shieh SY.
Oncogene 2012 Jul; 31(27):3287.
Application：IF, Human, IMR90 cells.
-
DNA Topoisomerase III Alpha Regulates p53-Mediated Tumor Suppression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com