Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CSTB polyclonal antibody

  • Catalog # : PAB30012
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human CSTB.
  • Immunogen:
  • A synthetic peptide corresponding to internal region of human CSTB.
  • Sequence:
  • AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 11
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot (0.25 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of transfected 293T cell lysate with CSTB polyclonal antibody (Cat # PAB30012) at 0.25 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CSTB polyclonal antibody (Cat # PAB30012) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1476
  • Protein Accession#:
  • NP_000091;P04080
  • Gene Name:
  • CSTB
  • Gene Alias:
  • CST6,EPM1,PME,STFB
  • Gene Description:
  • cystatin B (stefin B)
  • Gene Summary:
  • The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). [provided by RefSeq
  • Other Designations:
  • CPI-B,cystatin B,liver thiol proteinase inhibitor,stefin B
  • RSS
  • YouTube
  • Linkedin
  • Facebook