STAT1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human cell line A-431 Lane 4: Human liver tissue Lane 5: Human tonsil tissue with STAT1 polyclonal antibody (Cat # PAB29352) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human urinary bladder with STAT1 polyclonal antibody (Cat # PAB29352) shows strong nuclear and cytoplasmic positivity in urothelial cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with STAT1 polyclonal antibody (Cat # PAB29352) at 1-4 ug/mL concentration shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human STAT1.
Immunogen
Recombinant protein corresponding to human STAT1.
Sequence
FQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human cell line A-431 Lane 4: Human liver tissue Lane 5: Human tonsil tissue with STAT1 polyclonal antibody (Cat # PAB29352) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human urinary bladder with STAT1 polyclonal antibody (Cat # PAB29352) shows strong nuclear and cytoplasmic positivity in urothelial cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with STAT1 polyclonal antibody (Cat # PAB29352) at 1-4 ug/mL concentration shows positivity in cytoplasm. -
Gene Info — STAT1
Entrez GeneID
6772Gene Name
STAT1
Gene Alias
DKFZp686B04100, ISGF-3, STAT91
Gene Description
signal transducer and activator of transcription 1, 91kDa
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000165047|signal transducer and activator of transcription 1|signal transducer and activator of transcription-1|transcription factor ISGF-3 components p91/p84
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com