Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CSF1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3649
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CSF1 (P09603, 33 a.a. - 181 a.a.) partial recombinant protein expressed in baculovirus infected Bombyx Mori.
  • Sequence:
  • EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 42
  • Form:
  • Lyophilized
  • Preparation Method:
  • Bombyx Mori expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent stimulation of the proliferation of of M-NFS-60 cells is <1.0 ng/mL, corresponding to a specific activity of >1 x 106 units/mg.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.0 (1% HSA, 3% mannitol)
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1435
  • Gene Name:
  • CSF1
  • Gene Alias:
  • MCSF,MGC31930
  • Gene Description:
  • colony stimulating factor 1 (macrophage)
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000013362,OTTHUMP00000013363,OTTHUMP00000013364,colony stimulating factor 1,macrophage colony stimulating factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook