CSF1 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Lane 1: non-reducing conditions
Lane 2: reducing conditions
Result of activity analysis
Result of activity analysis
Serial dilutions of human CSF1, starting at 50 ng/mL, were added to NSF-60 cells. Cell proliferation was measured after 44 hours and the linear portion of the curve was us used to calculate the ED50.
-
Specification
Product Description
Human CSF1 (P09603) recombinant protein expressed in Escherichia coli.
Sequence
MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
Host
Escherichia coli
Theoretical MW (kDa)
36.8
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the dose-dependent proliferation of mouse NFS-60 cells. The expected ED50 for this effect is 1.4-2.1 ng/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Lane 1: non-reducing conditions
Lane 2: reducing conditionsStorage Buffer
Lyophilized from 10 mM Na2PO4, 50 mM NaCl, pH 8.0
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — CSF1
Entrez GeneID
1435Protein Accession#
P09603Gene Name
CSF1
Gene Alias
MCSF, MGC31930
Gene Description
colony stimulating factor 1 (macrophage)
Omim ID
120420Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000013362|OTTHUMP00000013363|OTTHUMP00000013364|colony stimulating factor 1|macrophage colony stimulating factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com