Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF21 monoclonal antibody (M53), clone 8H6

  • Catalog # : H00027242-M53
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TNFRSF21.
  • Immunogen:
  • TNFRSF21 (AAH17730.1, 89 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • TNFRSF21
  • Gene Alias:
  • BM-018,DR6,MGC31965
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 21
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016561,OTTHUMP00000039915,TNFR-related death receptor 6,death receptor 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook