Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NIFUN purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00023479-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NIFUN protein.
  • Immunogen:
  • NIFUN (NP_055116, 1 a.a. ~ 142 a.a) full-length human protein.
  • Sequence:
  • MVLIDMSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ISCU expression in transfected 293T cell line (H00023479-T01) by ISCU MaxPab polyclonal antibody.

    Lane 1: NIFUN transfected lysate(15.62 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ISCU
  • Gene Alias:
  • 2310020H20Rik,HML,ISU2,MGC74517,NIFU,NIFUN,hnifU
  • Gene Description:
  • iron-sulfur cluster scaffold homolog (E. coli)
  • Gene Summary:
  • Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. [provided by RefSeq
  • Other Designations:
  • IscU iron-sulfur cluster scaffold homolog,NifU-like N-terminal domain containing,iron-sulfur cluster assembly enzyme,nitrogen fixation cluster-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook