NIFUN monoclonal antibody (M01), clone 3B8-1C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NIFUN.
Immunogen
NIFUN (AAH11906, 26 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.36 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NIFUN monoclonal antibody (M01), clone 3B8-1C4 Western Blot analysis of NIFUN expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NIFUN is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NIFUN on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ISCU
Entrez GeneID
23479GeneBank Accession#
BC011906Protein Accession#
AAH11906Gene Name
ISCU
Gene Alias
2310020H20Rik, HML, ISU2, MGC74517, NIFU, NIFUN, hnifU
Gene Description
iron-sulfur cluster scaffold homolog (E. coli)
Gene Ontology
HyperlinkGene Summary
Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. [provided by RefSeq
Other Designations
IscU iron-sulfur cluster scaffold homolog|NifU-like N-terminal domain containing|iron-sulfur cluster assembly enzyme|nitrogen fixation cluster-like
-
Interactome
-
Publication Reference
-
Metabolic adaptation to chronic hypoxia in cardiac mitochondria.
Heather LC, Cole MA, Tan JJ, Ambrose LJ, Pope S, Abd-Jamil AH, Carter EE, Dodd MS, Yeoh KK, Schofield CJ, Clarke K.
Basic Research in Cardiology 2012 May; 107(3):268.
Application:WB-Ti, Rat, Rat hearts.
-
Metabolic adaptation to chronic hypoxia in cardiac mitochondria.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com